Lineage for d1ksja_ (1ksj A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1362830Protein ADP-ribosylation factor [52614] (16 species)
  7. 1362894Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (4 PDB entries)
  8. 1362899Domain d1ksja_: 1ksj A: [72916]
    Other proteins in same PDB: d1ksjb_
    complexed with GMP-PDE delta
    complexed with bme, gdp, gtp, mg, po4

Details for d1ksja_

PDB Entry: 1ksj (more details), 2.6 Å

PDB Description: complex of arl2 and pde delta, crystal form 2 (semet)
PDB Compounds: (A:) arf-like protein 2

SCOPe Domain Sequences for d1ksja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksja_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr

SCOPe Domain Coordinates for d1ksja_:

Click to download the PDB-style file with coordinates for d1ksja_.
(The format of our PDB-style files is described here.)

Timeline for d1ksja_: