SCOP 1.67: Domain d1ksja_: 1ksj A:

Lineage for d1ksja_ (1ksj A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (8 species)

7. Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (3 PDB entries)

8. Domain d1ksja_: 1ksj A: [72916]
   Other proteins in same PDB: d1ksjb_
   complexed with GMP-PDE delta
   complexed with bme, cme, gdp, gtp, mg, mse, po4; mutant

Details for d1ksja_

PDB Entry: 1ksj, 2.6 Å

PDB Description: complex of arl2 and pde delta, crystal form 2 (semet)

SCOP Domain Sequences for d1ksja_:

Sequence; same for both SEQRES and ATOM records:

>d1ksja_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr

Timeline for d1ksja_:

• d1ksja_ first appeared in SCOP 1.61
  
• d1ksja_ appears in SCOP 1.65
  
• d1ksja_ appears in SCOP 1.69
  
• d1ksja_ appears in the current release, SCOPe 2.08