Lineage for d1kshb_ (1ksh B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765600Protein GMP-PDE delta [74846] (1 species)
  7. 2765601Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)
  8. 2765607Domain d1kshb_: 1ksh B: [72915]
    Other proteins in same PDB: d1ksha_
    complexed with ARL2
    complexed with gdp, mg, po4

Details for d1kshb_

PDB Entry: 1ksh (more details), 1.8 Å

PDB Description: complex of arl2 and pde delta, crystal form 2 (native)
PDB Compounds: (B:) retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase delta-subunit

SCOPe Domain Sequences for d1kshb_:

Sequence, based on SEQRES records: (download)

>d1kshb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records): (download)

>d1kshb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliempasvltgnvi
ietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d1kshb_:

Click to download the PDB-style file with coordinates for d1kshb_.
(The format of our PDB-style files is described here.)

Timeline for d1kshb_: