Lineage for d1ksha_ (1ksh A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 581860Protein ADP-ribosylation factor [52614] (8 species)
  7. 581891Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (3 PDB entries)
  8. 581892Domain d1ksha_: 1ksh A: [72914]
    Other proteins in same PDB: d1kshb_
    complexed with GMP-PDE delta
    complexed with cme, gdp, mg, po4; mutant

Details for d1ksha_

PDB Entry: 1ksh (more details), 1.8 Å

PDB Description: complex of arl2 and pde delta, crystal form 2 (native)

SCOP Domain Sequences for d1ksha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr

SCOP Domain Coordinates for d1ksha_:

Click to download the PDB-style file with coordinates for d1ksha_.
(The format of our PDB-style files is described here.)

Timeline for d1ksha_: