SCOPe 2.06: Domain d1ks2b1: 1ks2 B:2-126,B:199-219

Lineage for d1ks2b1 (1ks2 B:2-126,B:199-219)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
   share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits

6. Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)

7. Species Escherichia coli [TaxId:562] [75178] (3 PDB entries)

8. Domain d1ks2b1: 1ks2 B:2-126,B:199-219 [72910]
   Other proteins in same PDB: d1ks2a2, d1ks2b2
   structural genomics

Details for d1ks2b1

PDB Entry: 1ks2, 1.5 Å

PDB Description: crystal structure analysis of the rpia, structural genomics, protein ec1268.

PDB Compounds: (B:) protein EC1268, RPIA

SCOPe Domain Sequences for d1ks2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ks2b1 c.124.1.4 (B:2-126,B:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]}
tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
qvdilXanrgadvaligtpdgvktivk

Timeline for d1ks2b1:

• d1ks2b1 first appeared in SCOP 1.61
  
• d1ks2b1 appears in SCOPe 2.05
  
• d1ks2b1 appears in SCOPe 2.07
  
• d1ks2b1 appears in the current release, SCOPe 2.08