SCOPe 2.06: Domain d1krvc_: 1krv C:

Lineage for d1krvc_ (1krv C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Galactoside acetyltransferase [75028] (1 species)

7. Species Escherichia coli [TaxId:562] [75029] (4 PDB entries)

8. Domain d1krvc_: 1krv C: [72907]
   complexed with 147, coa

Details for d1krvc_

PDB Entry: 1krv, 2.8 Å

PDB Description: galactoside acetyltransferase in complex with coa and pnp-beta-gal

PDB Compounds: (C:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d1krvc_:

Sequence; same for both SEQRES and ATOM records:

>d1krvc_ b.81.1.3 (C:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}
nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
ireindrdkhyyfkdykvess

Timeline for d1krvc_:

• d1krvc_ first appeared in SCOP 1.61
  
• d1krvc_ appears in SCOPe 2.05
  
• d1krvc_ appears in SCOPe 2.07
  
• d1krvc_ appears in the current release, SCOPe 2.08