SCOPe 2.07: Domain d1krhb1: 1krh B:106-205

Lineage for d1krhb1 (1krh B:106-205)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Benzoate dioxygenase reductase [74959] (1 species)

7. Species Acinetobacter sp. [TaxId:472] [74960] (1 PDB entry)

8. Domain d1krhb1: 1krh B:106-205 [72894]
   Other proteins in same PDB: d1krha2, d1krha3, d1krhb2, d1krhb3
   contains 2Fe-2S cluster in the C-terminal extension
   complexed with fad, fes, so4

Details for d1krhb1

PDB Entry: 1krh, 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase

PDB Compounds: (B:) Benzoate 1,2-Dioxygenase Reductase

SCOPe Domain Sequences for d1krhb1:

Sequence; same for both SEQRES and ATOM records:

>d1krhb1 b.43.4.2 (B:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}
ihhfegtlarvenlsdstitfdiqlddgqpdihflagqyvnvtlpgttetrsysfssqpg
nrltgfvvrnvpqgkmseylsvqakagdkmsftgpfgsfy

Timeline for d1krhb1:

• d1krhb1 first appeared in SCOP 1.61
  
• d1krhb1 appears in SCOPe 2.06
  
• d1krhb1 appears in the current release, SCOPe 2.08