Lineage for d1kqgc_ (1kqg C:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456466Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1456467Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1456468Family f.21.1.1: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein)
    automatically mapped to Pfam PF00033
    automatically mapped to Pfam PF01292
  6. 1456469Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species)
  7. 1456470Species Escherichia coli [TaxId:562] [75647] (2 PDB entries)
  8. 1456472Domain d1kqgc_: 1kqg C: [72878]
    Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb1, d1kqgb2
    complexed with 6mo, cdl, hem, hqo, mgd, sf4

Details for d1kqgc_

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (C:) formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit

SCOPe Domain Sequences for d1kqgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqgc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]}
skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
gmiegkvsrrwakkhhprwyreiekaeakkeseegi

SCOPe Domain Coordinates for d1kqgc_:

Click to download the PDB-style file with coordinates for d1kqgc_.
(The format of our PDB-style files is described here.)

Timeline for d1kqgc_: