Lineage for d1kqgc_ (1kqg C:)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (13 families) 
Family f.2.1.14: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein) Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species) Species Escherichia coli [TaxId:562] [75647] (2 PDB entries) 
Domain d1kqgc_: 1kqg C: [72878]
Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb_
Details for d1kqgc_
PDB Entry: 1kqg (more details), 2.8 Å
PDB Description: formate dehydrogenase n from e. coli
SCOP Domain Sequences for d1kqgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqgc_ f.2.1.14 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli}
skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
gmiegkvsrrwakkhhprwyreiekaeakkeseegi
SCOP Domain Coordinates for d1kqgc_:
Click to download the PDB-style file with coordinates for d1kqgc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kqgc_:
- d1kqgc_ is new in SCOP 1.61
- d1kqgc_ appears in SCOP 1.63
- d1kqgc_ appears in the current release, SCOPe 2.08
View in 3D
