![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.1: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein) automatically mapped to Pfam PF00033 automatically mapped to Pfam PF01292 |
![]() | Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75647] (2 PDB entries) |
![]() | Domain d1kqgc_: 1kqg C: [72878] Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgb1, d1kqgb2 complexed with 6mo, cdl, hem, hqo, mgd, sf4 |
PDB Entry: 1kqg (more details), 2.8 Å
SCOPe Domain Sequences for d1kqgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqgc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik gmiegkvsrrwakkhhprwyreiekaeakkeseegi
Timeline for d1kqgc_:
![]() Domains from other chains: (mouse over for more information) d1kqga1, d1kqga2, d1kqgb1, d1kqgb2 |