Lineage for d1kqgb_ (1kqg B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 191936Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 192023Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (6 proteins)
  6. 192061Protein Formate dehydrogenase N, iron-sulfur (beta) subunit [75427] (1 species)
  7. 192062Species Escherichia coli [TaxId:562] [75428] (2 PDB entries)
  8. 192064Domain d1kqgb_: 1kqg B: [72877]
    Other proteins in same PDB: d1kqga1, d1kqga2, d1kqgc_

Details for d1kqgb_

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli

SCOP Domain Sequences for d1kqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqgb_ d.58.1.5 (B:) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli}
ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
kdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee

SCOP Domain Coordinates for d1kqgb_:

Click to download the PDB-style file with coordinates for d1kqgb_.
(The format of our PDB-style files is described here.)

Timeline for d1kqgb_: