Lineage for d1kqga2 (1kqg A:34-850)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185542Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 185543Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 185544Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (6 proteins)
  6. 185579Protein Formate dehydrogenase N, alpha subunit [75317] (1 species)
  7. 185580Species Escherichia coli [TaxId:562] [75318] (2 PDB entries)
  8. 185582Domain d1kqga2: 1kqg A:34-850 [72876]
    Other proteins in same PDB: d1kqga1, d1kqgb_, d1kqgc_

Details for d1kqga2

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli

SCOP Domain Sequences for d1kqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqga2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli}
qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvchgptvaslaptfgrgam
tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
gnaapgtptgpfimqpegmgrlfainkmaegpfpehy

SCOP Domain Coordinates for d1kqga2:

Click to download the PDB-style file with coordinates for d1kqga2.
(The format of our PDB-style files is described here.)

Timeline for d1kqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kqga1