Lineage for d1kqga2 (1kqg A:34-850)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (2 families) (S)
    molybdopterine enzyme
  5. Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. Protein Formate dehydrogenase N, alpha subunit [75317] (1 species)
  7. Species Escherichia coli [TaxId:562] [75318] (2 PDB entries)
  8. Domain d1kqga2: 1kqg A:34-850 [72876]
    Other proteins in same PDB: d1kqga1, d1kqgb1, d1kqgb2, d1kqgc_
    complexed with 6mo, cdl, hem, hqo, mgd, sf4
    has additional insertions and/or extensions that are not grouped together

Details for d1kqga2

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (A:) formate dehydrogenase, nitrate-inducible, major subunit

SCOPe Domain Sequences for d1kqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqga2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]}
qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvahgptvaslaptfgrgam
tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
gnaapgtptgpfimqpegmgrlfainkmaegpfpehy

SCOPe Domain Coordinates for d1kqga2 are not available.

Timeline for d1kqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kqga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kqgb1, d1kqgb2, d1kqgc_