Lineage for d1kqga1 (1kqg A:851-1015)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169434Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 169448Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 169454Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (6 proteins)
  6. 169489Protein Formate dehydrogenase N, alpha subunit [74987] (1 species)
  7. 169490Species Escherichia coli [TaxId:562] [74988] (2 PDB entries)
  8. 169492Domain d1kqga1: 1kqg A:851-1015 [72875]
    Other proteins in same PDB: d1kqga2, d1kqgb_, d1kqgc_

Details for d1kqga1

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli

SCOP Domain Sequences for d1kqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqga1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli}
epietplgtnplhpnvvsnpvvrlyeqdalrmgkkeqfpyvgttyrltehfhtwtkhall
naiaqpeqfveisetlaaakginngdrvtvsskrgfiravavvtrrlkplnvngqqvetv
gipihwgfegvarkgyiantltpnvgdansqtpeykaflvnieka

SCOP Domain Coordinates for d1kqga1:

Click to download the PDB-style file with coordinates for d1kqga1.
(The format of our PDB-style files is described here.)

Timeline for d1kqga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kqga2