Lineage for d1kqga1 (1kqg A:851-1015)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802713Protein Formate dehydrogenase N, alpha subunit [74987] (1 species)
  7. 2802714Species Escherichia coli [TaxId:562] [74988] (2 PDB entries)
  8. 2802716Domain d1kqga1: 1kqg A:851-1015 [72875]
    Other proteins in same PDB: d1kqga2, d1kqgb1, d1kqgb2, d1kqgc_
    complexed with 6mo, cdl, hem, hqo, mgd, sf4

Details for d1kqga1

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (A:) formate dehydrogenase, nitrate-inducible, major subunit

SCOPe Domain Sequences for d1kqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqga1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]}
epietplgtnplhpnvvsnpvvrlyeqdalrmgkkeqfpyvgttyrltehfhtwtkhall
naiaqpeqfveisetlaaakginngdrvtvsskrgfiravavvtrrlkplnvngqqvetv
gipihwgfegvarkgyiantltpnvgdansqtpeykaflvnieka

SCOPe Domain Coordinates for d1kqga1:

Click to download the PDB-style file with coordinates for d1kqga1.
(The format of our PDB-style files is described here.)

Timeline for d1kqga1: