Lineage for d1kqfc_ (1kqf C:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 202052Family f.2.1.14: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein)
  6. 202053Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species)
  7. 202054Species Escherichia coli [TaxId:562] [75647] (2 PDB entries)
  8. 202055Domain d1kqfc_: 1kqf C: [72874]
    Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb_

Details for d1kqfc_

PDB Entry: 1kqf (more details), 1.6 Å

PDB Description: formate dehydrogenase n from e. coli

SCOP Domain Sequences for d1kqfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqfc_ f.2.1.14 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli}
skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
gmiegkvsrrwakkhhprwyreiekaeakkeseegi

SCOP Domain Coordinates for d1kqfc_:

Click to download the PDB-style file with coordinates for d1kqfc_.
(The format of our PDB-style files is described here.)

Timeline for d1kqfc_: