Lineage for d1kqfc_ (1kqf C:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. Family f.21.1.1: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein)
    automatically mapped to Pfam PF00033
    automatically mapped to Pfam PF01292
  6. Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species)
  7. Species Escherichia coli [TaxId:562] [75647] (2 PDB entries)
  8. Domain d1kqfc_: 1kqf C: [72874]
    Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb1, d1kqfb2
    complexed with 6mo, cdl, hem, mgd, sf4

Details for d1kqfc_

PDB Entry: 1kqf (more details), 1.6 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (C:) formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit

SCOPe Domain Sequences for d1kqfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]}
skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
gmiegkvsrrwakkhhprwyreiekaeakkeseegi

SCOPe Domain Coordinates for d1kqfc_ are not available.

Timeline for d1kqfc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kqfa1, d1kqfa2, d1kqfb1, d1kqfb2