SCOPe 2.08: Domain d1kqfc_: 1kqf C:

Lineage for d1kqfc_ (1kqf C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.1: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein)
   automatically mapped to Pfam PF00033
   automatically mapped to Pfam PF01292

6. Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species)

7. Species Escherichia coli [TaxId:562] [75647] (2 PDB entries)

8. Domain d1kqfc_: 1kqf C: [72874]
   Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb1, d1kqfb2
   complexed with 6mo, cdl, hem, mgd, sf4

Details for d1kqfc_

PDB Entry: 1kqf, 1.6 Å

PDB Description: formate dehydrogenase n from e. coli

PDB Compounds: (C:) formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit

SCOPe Domain Sequences for d1kqfc_:

Sequence; same for both SEQRES and ATOM records:

>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]}
skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
gmiegkvsrrwakkhhprwyreiekaeakkeseegi

Timeline for d1kqfc_:

• d1kqfc_ first appeared in SCOP 1.61
  
• d1kqfc_ appears in SCOPe 2.07