Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.1: Formate dehydrogenase N, cytochrome (gamma) subunit [75645] (1 protein) automatically mapped to Pfam PF00033 automatically mapped to Pfam PF01292 |
Protein Formate dehydrogenase N, cytochrome (gamma) subunit [75646] (1 species) |
Species Escherichia coli [TaxId:562] [75647] (2 PDB entries) |
Domain d1kqfc_: 1kqf C: [72874] Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb1, d1kqfb2 complexed with 6mo, cdl, hem, mgd, sf4 |
PDB Entry: 1kqf (more details), 1.6 Å
SCOPe Domain Sequences for d1kqfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik gmiegkvsrrwakkhhprwyreiekaeakkeseegi
Timeline for d1kqfc_:
View in 3D Domains from other chains: (mouse over for more information) d1kqfa1, d1kqfa2, d1kqfb1, d1kqfb2 |