SCOPe 2.06: Domain d1kqab_: 1kqa B:

Lineage for d1kqab_ (1kqa B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Galactoside acetyltransferase [75028] (1 species)

7. Species Escherichia coli [TaxId:562] [75029] (4 PDB entries)

8. Domain d1kqab_: 1kqa B: [72869]
   complexed with coa

Details for d1kqab_

PDB Entry: 1kqa, 3.2 Å

PDB Description: galactoside acetyltransferase in complex with coenzyme a

PDB Compounds: (B:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d1kqab_:

Sequence; same for both SEQRES and ATOM records:

>d1kqab_ b.81.1.3 (B:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}
nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
ireindrdkhyyfkdykves

Timeline for d1kqab_:

• d1kqab_ first appeared in SCOP 1.61
  
• d1kqab_ appears in SCOPe 2.05
  
• d1kqab_ appears in SCOPe 2.07
  
• d1kqab_ appears in the current release, SCOPe 2.08