SCOP 1.61: Domain d1kq1y_: 1kq1 Y:

Lineage for d1kq1y_ (1kq1 Y:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.38: Sm-like fold [50181] (2 superfamilies)

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)

6. Protein Pleiotropic translational regulator Hfq [74940] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)

8. Domain d1kq1y_: 1kq1 Y: [72859]

Details for d1kq1y_

PDB Entry: 1kq1, 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq

SCOP Domain Sequences for d1kq1y_:

Sequence; same for both SEQRES and ATOM records:

>d1kq1y_ b.38.1.2 (Y:) Pleiotropic translational regulator Hfq {Staphylococcus aureus}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv

Timeline for d1kq1y_:

• d1kq1y_ is new in SCOP 1.61
  
• d1kq1y_ appears in SCOP 1.63
  
• d1kq1y_ appears in the current release, SCOPe 2.08