Lineage for d1knna_ (1knn A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167295Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 167430Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 167431Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 167453Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 167454Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries)
  8. 167457Domain d1knna_: 1knn A: [72782]

Details for d1knna_

PDB Entry: 1knn (more details), 1.7 Å

PDB Description: Strepromyces lividans Xylan Binding Domain cbm13 in Complex with Xylopentaose

SCOP Domain Sequences for d1knna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knna_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans}
dggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcldaag
tsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsngsn
qrwtrt

SCOP Domain Coordinates for d1knna_:

Click to download the PDB-style file with coordinates for d1knna_.
(The format of our PDB-style files is described here.)

Timeline for d1knna_:

  • d1knna_ is new in SCOP 1.61
  • d1knna_ became obsolete in SCOP 1.63