Lineage for d1kn2l2 (1kn2 L:108-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549912Domain d1kn2l2: 1kn2 L:108-214 [72763]
    Other proteins in same PDB: d1kn2h1, d1kn2h2, d1kn2l1
    part of Fab D2.3
    complexed with pne, zn

Details for d1kn2l2

PDB Entry: 1kn2 (more details), 1.9 Å

PDB Description: catalytic antibody d2.3 complex

SCOP Domain Sequences for d1kn2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn2l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1kn2l2:

Click to download the PDB-style file with coordinates for d1kn2l2.
(The format of our PDB-style files is described here.)

Timeline for d1kn2l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kn2l1