Lineage for d1kn2h1 (1kn2 H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652601Domain d1kn2h1: 1kn2 H:1-113 [72760]
    Other proteins in same PDB: d1kn2h2, d1kn2l1, d1kn2l2
    part of Fab D2.3
    complexed with pne, zn

Details for d1kn2h1

PDB Entry: 1kn2 (more details), 1.9 Å

PDB Description: catalytic antibody d2.3 complex
PDB Compounds: (H:) ig antibody d2.3 (heavy chain)

SCOP Domain Sequences for d1kn2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn2h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

SCOP Domain Coordinates for d1kn2h1:

Click to download the PDB-style file with coordinates for d1kn2h1.
(The format of our PDB-style files is described here.)

Timeline for d1kn2h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kn2h2