SCOP 1.61: Domain d1kn2h1: 1kn2 H:1-113

Lineage for d1kn2h1 (1kn2 H:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab D2.3 (mouse), kappa L chain [48829] (6 PDB entries)

8. Domain d1kn2h1: 1kn2 H:1-113 [72760]
   Other proteins in same PDB: d1kn2h2, d1kn2l2

Details for d1kn2h1

PDB Entry: 1kn2, 1.9 Å

PDB Description: catalytic antibody d2.3 complex

SCOP Domain Sequences for d1kn2h1:

Sequence; same for both SEQRES and ATOM records:

>d1kn2h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

Timeline for d1kn2h1:

• d1kn2h1 is new in SCOP 1.61
  
• d1kn2h1 appears in SCOP 1.63
  
• d1kn2h1 appears in the current release, SCOPe 2.08