SCOPe 2.01: Domain d1kmhb2: 1kmh B:19-97

Lineage for d1kmhb2 (1kmh B:19-97)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88681] (2 PDB entries)

8. Domain d1kmhb2: 1kmh B:19-97 [72749]
   Other proteins in same PDB: d1kmha1, d1kmha2, d1kmha3, d1kmhb1, d1kmhb3
   complexed with ttx

Details for d1kmhb2

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

PDB Compounds: (B:) ATPase beta subunit

SCOPe Domain Sequences for d1kmhb2:

Sequence; same for both SEQRES and ATOM records:

>d1kmhb2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
msatdgltrgmevidtgap

Timeline for d1kmhb2:

• d1kmhb2 first appeared in SCOP 1.61
  
• d1kmhb2 appears in SCOP 1.75
  
• d1kmhb2 appears in SCOPe 2.02
  
• d1kmhb2 appears in the current release, SCOPe 2.08