Lineage for d1kmhb1 (1kmh B:378-485)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215201Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 215202Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 215203Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 215204Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 215266Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63576] (2 PDB entries)
  8. 215270Domain d1kmhb1: 1kmh B:378-485 [72748]
    Other proteins in same PDB: d1kmha2, d1kmha3, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmhb1

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin

SCOP Domain Sequences for d1kmhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmhb1 a.69.1.1 (B:378-485) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

SCOP Domain Coordinates for d1kmhb1:

Click to download the PDB-style file with coordinates for d1kmhb1.
(The format of our PDB-style files is described here.)

Timeline for d1kmhb1: