Lineage for d1kmha2 (1kmh A:25-96)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299710Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 299711Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 299712Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 299713Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 299749Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries)
  8. 299751Domain d1kmha2: 1kmh A:25-96 [72746]
    Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmha2

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin

SCOP Domain Sequences for d1kmha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOP Domain Coordinates for d1kmha2:

Click to download the PDB-style file with coordinates for d1kmha2.
(The format of our PDB-style files is described here.)

Timeline for d1kmha2: