Lineage for d1kmha2 (1kmh A:25-96)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168781Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 168782Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 168783Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 168784Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 168846Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (2 PDB entries)
  8. 168849Domain d1kmha2: 1kmh A:25-96 [72746]
    Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb3

Details for d1kmha2

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin

SCOP Domain Sequences for d1kmha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha2 b.49.1.1 (A:25-96) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOP Domain Coordinates for d1kmha2:

Click to download the PDB-style file with coordinates for d1kmha2.
(The format of our PDB-style files is described here.)

Timeline for d1kmha2: