Lineage for d1kmha1 (1kmh A:373-501)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091605Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1091606Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1091607Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1091608Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 1091657Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88927] (2 PDB entries)
  8. 1091659Domain d1kmha1: 1kmh A:373-501 [72745]
    Other proteins in same PDB: d1kmha2, d1kmha3, d1kmhb1, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmha1

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin
PDB Compounds: (A:) ATPase alpha subunit

SCOPe Domain Sequences for d1kmha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
ikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltve
eqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallke
aiqeqmerf

SCOPe Domain Coordinates for d1kmha1:

Click to download the PDB-style file with coordinates for d1kmha1.
(The format of our PDB-style files is described here.)

Timeline for d1kmha1: