Lineage for d1kmha1 (1kmh A:373-501)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215201Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 215202Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 215203Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 215204Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 215266Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63576] (2 PDB entries)
  8. 215269Domain d1kmha1: 1kmh A:373-501 [72745]
    Other proteins in same PDB: d1kmha2, d1kmha3, d1kmhb2, d1kmhb3

Details for d1kmha1

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin

SCOP Domain Sequences for d1kmha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha1 a.69.1.1 (A:373-501) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
ikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltve
eqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallke
aiqeqmerf

SCOP Domain Coordinates for d1kmha1:

Click to download the PDB-style file with coordinates for d1kmha1.
(The format of our PDB-style files is described here.)

Timeline for d1kmha1: