SCOPe 2.07: Domain d1km0b_: 1km0 B:

Lineage for d1km0b_ (1km0 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)

8. Domain d1km0b_: 1km0 B: [72733]
   Other proteins in same PDB: d1km0a2, d1km0c2
   complexed with up6; mutant

Details for d1km0b_

PDB Entry: 1km0, 1.7 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant d70n complexed with 6-azaump

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1km0b_:

Sequence; same for both SEQRES and ATOM records:

>d1km0b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriian
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

Timeline for d1km0b_:

• d1km0b_ first appeared in SCOP 1.61
  
• d1km0b_ appears in SCOPe 2.06
  
• d1km0b_ appears in the current release, SCOPe 2.08