Lineage for d1klud2 (1klu D:122-239)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541538Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 2541539Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 2541540Domain d1klud2: 1klu D:122-239 [72729]
    Other proteins in same PDB: d1klua1, d1klua2, d1klub1, d1klub2, d1klud1

Details for d1klud2

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1klud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klud2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1klud2:

Click to download the PDB-style file with coordinates for d1klud2.
(The format of our PDB-style files is described here.)

Timeline for d1klud2: