SCOPe 2.01: Domain d1klud2: 1klu D:122-239

Lineage for d1klud2 (1klu D:122-239)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries)
   Uniprot P23313

8. Domain d1klud2: 1klu D:122-239 [72729]
   Other proteins in same PDB: d1klua1, d1klua2, d1klub1, d1klub2, d1klud1

Details for d1klud2

PDB Entry: 1klu, 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1klud2:

Sequence; same for both SEQRES and ATOM records:

>d1klud2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1klud2:

• d1klud2 first appeared in SCOP 1.61
  
• d1klud2 appears in SCOP 1.75
  
• d1klud2 appears in SCOPe 2.02
  
• d1klud2 appears in the current release, SCOPe 2.08