![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54345] (7 PDB entries) |
![]() | Domain d1klud2: 1klu D:122-239 [72729] Other proteins in same PDB: d1klua1, d1klua2, d1klub1, d1klub2, d1klud1 |
PDB Entry: 1klu (more details), 1.93 Å
SCOP Domain Sequences for d1klud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klud2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1klud2:
![]() Domains from other chains: (mouse over for more information) d1klua1, d1klua2, d1klub1, d1klub2 |