SCOPe 2.08: Domain d1klub2: 1klu B:1-92

Lineage for d1klub2 (1klu B:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)

8. Domain d1klub2: 1klu B:1-92 [72727]
   Other proteins in same PDB: d1klua1, d1klua2, d1klub1, d1klud1, d1klud2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1klub2

PDB Entry: 1klu, 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1klub2:

Sequence; same for both SEQRES and ATOM records:

>d1klub2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1klub2:

• d1klub2 first appeared in SCOP 1.61
  
• d1klub2 appears in SCOPe 2.07