Lineage for d1klub1 (1klu B:93-190)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288980Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 288985Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries)
    probably orthologous to the mouse I-E group
  8. 288988Domain d1klub1: 1klu B:93-190 [72726]
    Other proteins in same PDB: d1klua1, d1klua2, d1klub2, d1klud1, d1klud2

Details for d1klub1

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klub1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1klub1:

Click to download the PDB-style file with coordinates for d1klub1.
(The format of our PDB-style files is described here.)

Timeline for d1klub1: