Lineage for d1klua2 (1klu A:4-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406537Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1406547Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 1406548Domain d1klua2: 1klu A:4-81 [72725]
    Other proteins in same PDB: d1klua1, d1klub1, d1klub2, d1klud1, d1klud2

Details for d1klua2

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1klua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klua2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1klua2:

Click to download the PDB-style file with coordinates for d1klua2.
(The format of our PDB-style files is described here.)

Timeline for d1klua2: