Lineage for d1klua2 (1klu A:4-81)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326900Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (11 PDB entries)
  8. 326901Domain d1klua2: 1klu A:4-81 [72725]
    Other proteins in same PDB: d1klua1, d1klub1, d1klub2, d1klud1, d1klud2

Details for d1klua2

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: Crystal structure of HLA-DR1/TPI(23-37) complexed with staphylococcal enterotoxin C3 variant 3B2 (SEC3-3B2)

SCOP Domain Sequences for d1klua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klua2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1klua2:

Click to download the PDB-style file with coordinates for d1klua2.
(The format of our PDB-style files is described here.)

Timeline for d1klua2: