Lineage for d1klua1 (1klu A:82-182)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220741Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries)
  8. 220742Domain d1klua1: 1klu A:82-182 [72724]
    Other proteins in same PDB: d1klua2, d1klub2, d1klud1, d1klud2

Details for d1klua1

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klua1 b.1.1.2 (A:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1klua1:

Click to download the PDB-style file with coordinates for d1klua1.
(The format of our PDB-style files is described here.)

Timeline for d1klua1: