SCOP 1.73: Domain d1klgd1: 1klg D:1-121

Lineage for d1klgd1 (1klg D:1-121)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)

8. Domain d1klgd1: 1klg D:1-121 [72718]
   Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd2
   mutant

Details for d1klgd1

PDB Entry: 1klg, 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (D:) Enterotoxin type C-3

SCOP Domain Sequences for d1klgd1:

Sequence, based on SEQRES records:

>d1klgd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records):

>d1klgd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskgktcmyggitkhegn

Timeline for d1klgd1:

• d1klgd1 first appeared in SCOP 1.61
  
• d1klgd1 appears in SCOP 1.71
  
• d1klgd1 appears in SCOP 1.75
  
• d1klgd1 appears in the current release, SCOPe 2.08