Lineage for d1klgb2 (1klg B:1-92)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856871Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 856874Domain d1klgb2: 1klg B:1-92 [72717]
    Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgd1, d1klgd2
    mutant

Details for d1klgb2

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOP Domain Sequences for d1klgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klgb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1klgb2:

Click to download the PDB-style file with coordinates for d1klgb2.
(The format of our PDB-style files is described here.)

Timeline for d1klgb2: