Lineage for d1klga1 (1klg A:82-180)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654857Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 654867Domain d1klga1: 1klg A:82-180 [72714]
    Other proteins in same PDB: d1klga2, d1klgb1, d1klgb2, d1klgd1, d1klgd2
    mutant

Details for d1klga1

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d1klga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klga1 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOP Domain Coordinates for d1klga1:

Click to download the PDB-style file with coordinates for d1klga1.
(The format of our PDB-style files is described here.)

Timeline for d1klga1: