![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries) probably orthologous to the mouse I-E group |
![]() | Domain d1klga1: 1klg A:82-180 [72714] Other proteins in same PDB: d1klga2, d1klgb1, d1klgb2, d1klgd1, d1klgd2 mutant |
PDB Entry: 1klg (more details), 2.4 Å
SCOP Domain Sequences for d1klga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klga1 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwef
Timeline for d1klga1:
![]() Domains from other chains: (mouse over for more information) d1klgb1, d1klgb2, d1klgd1, d1klgd2 |