SCOP 1.63: Domain d1klga1: 1klg A:82-180

Lineage for d1klga1 (1klg A:82-180)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries)

8. Domain d1klga1: 1klg A:82-180 [72714]
   Other proteins in same PDB: d1klga2, d1klgb2, d1klgd1, d1klgd2

Details for d1klga1

PDB Entry: 1klg, 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klga1:

Sequence; same for both SEQRES and ATOM records:

>d1klga1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d1klga1:

• d1klga1 first appeared in SCOP 1.61
  
• d1klga1 appears in SCOP 1.65
  
• d1klga1 appears in the current release, SCOPe 2.08