SCOPe 2.05: Domain d1klfd1: 1klf D:1-158

Lineage for d1klfd1 (1klf D:1-158)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)

8. Domain d1klfd1: 1klf D:1-158 [72688]
   Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2
   complexed with man

Details for d1klfd1

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (D:) FimH PROTEIN

SCOPe Domain Sequences for d1klfd1:

Sequence; same for both SEQRES and ATOM records:

>d1klfd1 b.2.3.2 (D:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1klfd1:

• d1klfd1 first appeared in SCOP 1.61
  
• d1klfd1 appears in SCOPe 2.04
  
• d1klfd1 appears in SCOPe 2.06
  
• d1klfd1 appears in the current release, SCOPe 2.08