SCOPe 2.05: Domain d1klfc1: 1klf C:1-121

Lineage for d1klfc1 (1klf C:1-121)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)

8. Domain d1klfc1: 1klf C:1-121 [72686]
   Other proteins in same PDB: d1klfa2, d1klfb1, d1klfb2, d1klfc2, d1klfd1, d1klfd2, d1klfe2, d1klff1, d1klff2, d1klfg2, d1klfh1, d1klfh2, d1klfi2, d1klfj1, d1klfj2, d1klfk2, d1klfl1, d1klfl2, d1klfm2, d1klfn1, d1klfn2, d1klfo2, d1klfp1, d1klfp2
   complexed with man

Details for d1klfc1

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d1klfc1:

Sequence; same for both SEQRES and ATOM records:

>d1klfc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d1klfc1:

• d1klfc1 first appeared in SCOP 1.61
  
• d1klfc1 appears in SCOPe 2.04
  
• d1klfc1 appears in SCOPe 2.06
  
• d1klfc1 appears in the current release, SCOPe 2.08