Lineage for d1kl5a_ (1kl5 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170267Domain d1kl5a_: 1kl5 A: [72674]

Details for d1kl5a_

PDB Entry: 1kl5 (more details), 1.8 Å

PDB Description: an engineered streptavidin with improved affinity for the strep-tag ii peptide : sam2-strepii

SCOP Domain Sequences for d1kl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kl5a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
s

SCOP Domain Coordinates for d1kl5a_:

Click to download the PDB-style file with coordinates for d1kl5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kl5a_: