Lineage for d1kl4a_ (1kl4 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958680Protein Streptavidin [50878] (1 species)
  7. 958681Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 958781Domain d1kl4a_: 1kl4 A: [72670]

Details for d1kl4a_

PDB Entry: 1kl4 (more details), 1.7 Å

PDB Description: an engineered streptavidin with improved affinity for the strep-tag ii peptide : apo-sam2
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1kl4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kl4a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d1kl4a_:

Click to download the PDB-style file with coordinates for d1kl4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kl4a_: