![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
![]() | Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
![]() | Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
![]() | Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries) |
![]() | Domain d1kkmh_: 1kkm H: [72657] Other proteins in same PDB: d1kkma_, d1kkmb_, d1kkmc_ P-Ser protein complexed with HprK/P kinase domain complexed with ca, po4 |
PDB Entry: 1kkm (more details), 2.8 Å
SCOPe Domain Sequences for d1kkmh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkmh_ d.94.1.1 (H:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]} aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei tisasgadendalnaleetmkserlge
Timeline for d1kkmh_: