Lineage for d1kkmb_ (1kkm B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186006Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
  4. 186007Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 186025Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
  6. 186026Protein HPr kinase HprK C-terminal domain [64187] (2 species)
  7. 186027Species Lactobacillus casei [TaxId:1582] [64188] (3 PDB entries)
  8. 186029Domain d1kkmb_: 1kkm B: [72655]
    Other proteins in same PDB: d1kkmh_, d1kkmi_, d1kkmj_

Details for d1kkmb_

PDB Entry: 1kkm (more details), 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis p-ser-hpr

SCOP Domain Sequences for d1kkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkmb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehneet

SCOP Domain Coordinates for d1kkmb_:

Click to download the PDB-style file with coordinates for d1kkmb_.
(The format of our PDB-style files is described here.)

Timeline for d1kkmb_: