SCOPe 2.07: Domain d1kkma_: 1kkm A:

Lineage for d1kkma_ (1kkm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
   automatically mapped to Pfam PF07475

6. Protein HPr kinase HprK C-terminal domain [64187] (3 species)

7. Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)

8. Domain d1kkma_: 1kkm A: [72654]
   Other proteins in same PDB: d1kkmh_, d1kkmi_, d1kkmj_
   C-terminal domain in complex with P-Ser-HPr
   complexed with ca, po4

Details for d1kkma_

PDB Entry: 1kkm, 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis p-ser-hpr

PDB Compounds: (A:) hprk protein

SCOPe Domain Sequences for d1kkma_:

Sequence; same for both SEQRES and ATOM records:

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

Timeline for d1kkma_:

• d1kkma_ first appeared in SCOP 1.61
  
• d1kkma_ appears in SCOPe 2.06
  
• d1kkma_ appears in the current release, SCOPe 2.08