Lineage for d1kkla_ (1kkl A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710202Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 710203Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 710233Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
  6. 710234Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 710235Species Lactobacillus casei [TaxId:1582] [64188] (3 PDB entries)
  8. 710239Domain d1kkla_: 1kkl A: [72648]
    Other proteins in same PDB: d1kklh_, d1kkli_, d1kklj_

Details for d1kkla_

PDB Entry: 1kkl (more details), 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis hpr
PDB Compounds: (A:) hprk protein

SCOP Domain Sequences for d1kkla_:

Sequence, based on SEQRES records: (download)

>d1kkla_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

Sequence, based on observed residues (ATOM records): (download)

>d1kkla_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdeqtqlifdvpvpki
tvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

SCOP Domain Coordinates for d1kkla_:

Click to download the PDB-style file with coordinates for d1kkla_.
(The format of our PDB-style files is described here.)

Timeline for d1kkla_: